Echinoderm and flatworm mitochondrial code

The echinoderm and flatworm mitochondrial code (translation table 9) is a genetic code used by the mitochondria of certain echinoderm and flatworm species.[1]

The code

   AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNNKSSSSVVVVAAAADDEEGGGG
Starts = -----------------------------------M---------------M------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V) Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code:
This code Standard
AAA Asn N Lys K
AGA Ser S Arg R
AGG Ser S Arg R
UGA Trp W Ter *

Systematic range

See also

References

  1. 1 2 "The Genetic Codes". Retrieved 18 March 2016.
  2. ↑ H. Himeno; H. Masaki; T. Kawai; T. Ohta; I. Kumagai; K. Miura; K. Watanabe (1987). "Unusual genetic codes and a novel gene structure for tRNA(AGYSer) in starfish mitochondrial DNA". Gene. 56 (2-3): 219–30. doi:10.1016/0378-1119(87)90139-9.
  3. ↑ H. T. Jacobs; D. J. Elliott; V. B. Math; A. Farquharson (20 July 1988). "Nucleotide sequence and gene organization of sea urchin mitochondrial DNA.". J Mol Biol. 202 (2): 185–217. doi:10.1016/0022-2836(88)90452-4.
  4. ↑ P. Cantatore; M. Roberti; G. Rainaldi; M. N. Gadaleta; C. Saccone (5 July 1989). "The complete nucleotide sequence, gene organization, and genetic code of the mitochondrial genome of Paracentrotus lividus". J Biol Chem. 264 (19): 10965–75.
  5. ↑ M. J. Telford; E. A. Herniou; R. B. Russell; D. T. Littlewood (10 October 2000). "Changes in mitochondrial genetic codes as phylogenetic characters: two examples from the flatworms". Proc Natl Acad Sci U S A. 97 (21): 11359–64. PMC 17205 Freely accessible. PMID 11027335. doi:10.1073/pnas.97.21.11359.


This article is issued from Wikipedia. The text is licensed under Creative Commons - Attribution - Sharealike. Additional terms may apply for the media files.