Talk:Protein sequencing
From Wikipedia, the free encyclopedia
 |
This article is within the scope of the Molecular and Cellular Biology WikiProject. To participate, visit the WikiProject for more information. The current monthly improvement drive is Signal transduction. |
||
| B | This article has been rated as B-Class on the assessment scale. |
||
| High | This article is on a subject of High-importance within molecular and cellular biology. | ||
|
Article Grading: The following comments were left by the quality and importance raters: (edit · refresh) Changed rating to "high" as this is an important method in molecular biology. - tameeria 22:14, 18 February 2007 (UTC) |
|||
Contents |
[edit] Possible copyright issue
The content of this page appears to have been cut and pasted from somewhere, but I have been unable to find a source. Does anybody know where the text of this article came from, and why it is formatted so strangely (with many hard line breaks, hypenated words broken over two lines, unwikified headings)? See Wikipedia:Copyrights. —AlanBarrett 19:12, 6 Nov 2004 (UTC)
- It seems well referenced, I took out the attempt at footnotes- and made it more -wiki- it still needs more work and clarification.--nixie 03:26, 9 Nov 2004 (UTC)
The content was cut and pasted from somewhere (a project I did for an assignment), but this is not a copyright violation because I wrote it and therefore own the copyright. you cannot find it anywhere else because I have not put it online anywhere else. At some point it might be put online by the online science journal "Phlogiston" of my school, Winchester College Gingekerr 18:06, 6 Dec 2004 (UTC)
- Meanwhile , this article was marked as a copyright violation from e-paranoids.com. I have reverted this; e-paranoids is a mirror of Wikipedia. --rbrwr± 12:35, 12 Dec 2004 (UTC)
-
- I put the suspected copyright violation mark on. As others suggested, some of the artefacts made it look like a copy. Thanks for establishing that it is innocent. And thanks to the author for writing it and releasing it. A little more editing may be useful. I don't understand the word 'derivatised', there may be another way of expressing the same thing. Bobblewik (talk) 20:25, 17 Dec 2004 (UTC)
- Derivatization is quite a specific biochemical process often used in analytical chemistry/biochemistry - it is the controlled conversion of a 'species' originally present in a sample into another form which allows its seperation by chromotography or detection by another means- there's no alternate term to describe it. This describes how derivatization works in gas chromotography--nixie 05:13, 19 Dec 2004 (UTC)
- I put the suspected copyright violation mark on. As others suggested, some of the artefacts made it look like a copy. Thanks for establishing that it is innocent. And thanks to the author for writing it and releasing it. A little more editing may be useful. I don't understand the word 'derivatised', there may be another way of expressing the same thing. Bobblewik (talk) 20:25, 17 Dec 2004 (UTC)
[edit] B and Z aminoacids
I think something about the Edman sequencing ambiguities should be added:
B: D or N (Asn or Asp, Asparagine or Aspartic acid) Z: E or Q (Glu or Gln, Glutamic acid or Glutamine)
Some protein databases, e.g. SwissProt, still contain B's and Z's. As many other databases import from SwissProt they also contain B's and Z's. E.g. from the IPI.human protein database:
>IPI:IPI00382474.1|SWISS-PROT:P01762 Tax_Id=9606 Ig heavy chain V-III region TRO QVQLVQSGGGLVKPGGSLRLSCVASGFSFRDFYMSWIRZTPGKGLZWVSYIGGSGSTLYY ADSVKGRFTISRDNAQKSLYLZMBSLRTZBTAVYYCAATBBFBWSTFSLBYWGZGBLVTV SS
Refs:
<http://www.ncbi.nlm.nih.gov/BLAST/fasta.shtml> From <http://www.healthsystem.virginia.edu/internet/biomolec/proteinscience.cfm>: "During acid hydrolysis, asparagine and glutamine are deamidated to aspartate and glutamate, respectively, rendering the acid and its corresponding amide indistinguishable. Tryptophan is destroyed under the standard hydrolysis conditions, and so is cysteine although to a lesser extent."
[edit] Broken refs
[edit] Broken refs
References #1 and #3 are broken:
<http://ntri.tamuk.edu/graduate/sequence.htm>
<http://www.med.unibs.it/marchesi/analysis.html>
[edit] Spelling convention (justifying recent revert)
I'm quite happy to accept "ioniZation" etc, where there is no classical root dictating the correct spelling (and also "color" etc where the classics side with the Americans) but not "hydrolyZe" - that is just plain wrong (anyway - how would you spell "hydrolysis"? "hydrolyzis" just looks stupid) Gingekerr 15:26, 4 August 2006 (UTC)
