Talk:Enaptin

From Wikipedia, the free encyclopedia

You have new messages (last change).
Molecular and Cellular Biology WikiProject
Portal:MCB
 MCB Portal
This article is within the scope of the Molecular and Cellular Biology WikiProject. To participate, visit the WikiProject for more information. The current monthly improvement drive is Signal transduction.

Article Grading: The article has not been rated for quality and/or importance yet. Please rate the article and then leave comments here to explain the ratings and/or to identify the strengths and weaknesses of the article..

wow

  • Could anyone explain why the word is so long?
  • It is not a word per se, but rather a chemical code, as with other similiar substances.

Contents

[edit] Look at the crap!

What was with all this:

MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKL- PCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSS- SASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELV- DLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQEDDEILP- GFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRD-

(times eight)

? --User:Alex12_3

  • Are you an idiot? Did you even try reading the article? -- BRIAN0918  03:22, 30 Mar 2005 (UTC)
  • Yeah, I didn't understand it either at first...... then I read the article --Headcase 05:09, 30 Mar 2005 (UTC)

[edit] Not the longest

It's been brought to my attention that the largest protein in the body is called titin (appropriately), and has 27,000 amino acids. Expect an article soon. -- BRIAN0918  05:28, 30 Mar 2005 (UTC)

  • Alright, it's official: 189,819 letters. -- BRIAN0918  05:43, 30 Mar 2005 (UTC)

[edit] Article be cleaned up please

Article be cleaned up please secfan 08:31, Mar 30, 2005 (UTC)

[edit] Removing that long word...

I suggest it be removed... and/or just linked to (or create a new page with this word), as it seems inappropriate in this main article, and people keep removing it not knowing why it was there in the first place. secfan 11:08, Mar 30, 2005 (UTC)

[edit] Thanks for the vandalism

Thanks for completely vandalizing and tearing to shreds my article overnight. Did any of you even bother to correct the vandalism in the page? No. You were too busy deleting all of its contents to notice the vandalism. -- BRIAN0918  12:58, 30 Mar 2005 (UTC)

[edit] How pitiful...

Just because the f***ing molecule's name is so long you are having a fight? Come to your senses! --Belgrader 17:59, 30 Mar 2005 (UTC)

Retrieved from "http://en.wikipedia.org../../../e/n/a/Talk%7EEnaptin_b73c.html"