Talk:Acetylseryltyrosylseryliso...serine
From Wikipedia, the free encyclopedia
 |
The spoken word version of this article is part of WikiProject Spoken Wikipedia, an attempt to produce recordings of Wikipedia articles being read aloud. If you would like to participate, visit the project page, where you can join the project and find out how to contribute. |
ok, how would you pronounce this word? What does it mean? where did it originate from and who made it...Very interesting...
- It appears to be the complete chemical name of a protein molecule; it's a long sequence of amino acid prefixes. Presumably, this protein is the primary constituent of the tobacco mosaic virus' protein coat (added note: just saw that the virus uses only a single type of protein in its coat, so this is probably it). If this is the case, though, I think it's misleading to say that this word is the name of the virus, since there's more to the virus than this one particular protein. Bryan 02:40, 26 Nov 2003 (UTC)
- Over on the Tobacco mosaic virus page it says that this word is virus' "RNA sequence". I think that's wrong, or at least also misleading, since an RNA molecule's name would have lots of "adenyl"-, "uracil"-, "guanyl"- and "cyto"-type subunits instead of the names of proteins. It could be what the RNA's codons code for, perhaps. Does anyone have access to the original article to find out exactly what's going on here? Bryan 02:46, 26 Nov 2003 (UTC)
-
- It's not misleading. Each protein is a specific sequence of three subunits, so naming the proteins is an easy way to save space over writing about triple the amount of text. See amino acid for more details; when I used this page for research for adding the abbreviation, I believe it mentioned the makeup of each protein in terms of these base units. I'm not looking now because my head hurts from having to parse the raw name and all its protein units into abbreviations. Ouch. Jeff Walden 21:45, 29 May 2004 (EDT)
-
-
- No, this is wrong. Each amino acid is coded for by a codon that consists of three RNA residues, but most amino acids can be coded for by several different codons so you can't work your way backward from protein sequence to RNA sequence - there are multiple different RNA sequences that will give you the exact same protein. Furthermore, the RNA will contain noncoding regions at the head and tail that don't get turned into protein at all. I'm going to go fix the TMV page now. Bryan 20:53, 15 Nov 2004 (UTC)
-
...and what would happen if its full name were used as the title? Paullusmagnus 02:39, 19 Oct 2003 (UTC)
- Cant we move this to A...serine? Muriel 11:59, 16 Nov 2003 (UTC)
- You get redirected silently to Bad title. [1] --Andy Janata 03:27, 19 September 2005 (UTC)
Guys, this protein has ONLY 157 amino acids (aa), while there are proteins out there that have thousands of aa, imagine how long their names would be. One such protein is VWF (2813 aa), and its name presented in one-letter code, is longer than the full name of TMV's coat protein:
MIPARFAGVLLALALILPGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQKRSF SIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARI DGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSC NISSGEMQKGLWEQCQLLKSTSVFARCHPLVDPEPFVALCEKTLCECAGGLECACPALLEYARTCAQEGM VLYGWTDHSACSPVCPAGMEYRQCVSPCARTCQSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPC VHSGKRYPPGTSLSRDCNTCICRNSQWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQD HSFSIVIETVQCADDRDAVCTRSVTVRLPGLHNSLVKLKHGAGVAMDGQDIQLPLLKGDLRIQHTVTASV RLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSGLAEPRVEDFGNAWKLHGDCQ DLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVSPLPYLRNCRYDVCSCSDGRECLCGALASYA AACAGRGVRVAWREPGRCELNCPKGQVYLQCGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERGD CVPKAQCPCYYDGEIFQPEDIFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPP MVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGE TVKIGCNTCVCRDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYLFPGECQYVLVQDYCGSNPGTFRILVG NKGCSHPSVKCKKRVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGRYIILLLGKALSVVWDRHLSI SVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVDFGNSWKVSSQCADTRKVPLDSSPATCHNNI MKQTMVDSSCRILTSDVFQDCNKLVDPEPYLDVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVTW RTATLCPQSCEERNLRENGYECEWRYNSCAPACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTC VDPEDCPVCEVAGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCEACQEPGGLVVPPTDAPVSPTTLYVE DISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIG LKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRY VQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPTLP PHMAQVTVGPGLLGVSTLGPKRNSMVLDVAFVLEGSDKIGEADFNRSKEFMEEVIQRMDVGQDSIHVTVL QYSYMVTVEYPFSEAQSKGDILQRVREIRYQGGNRTNTGLALRYLSDHSFLVSQGDREQAPNLVYMVTGN PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRCCSGEGLQIPTL SPAPDCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNVVPE KAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSVDSVDAAADAARSNRV TVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCSGFVRICMDEDGNEKRPG DVWTLPDQCHTVTCQPDGQTLLKSHRVNCDRGLRPSCPNSQSPVKVEETCGCRWTCPCVCTGSSTRHIVT FDGQNFKLTGSCSYVLFQNKEQDLEVILHNGACSPGARQGCMKSIEVKHSALSVELHSDMEVTVNGRLVS VPYVGGNMEVNVYGAIMHEVRFNHLGHIFTFTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFMLRD GTVTTDWKTLVQEWTVQRPGQTCQPILEEQCLVPDSSHCQVLLLPLFAECHKVLAPATFYAICQQDSCHQ EQVCEVIASYAHLCRTNGVCVDWRTPDFCAMSCPPSLVYNHCEHGCPRHCDGNVSSCGDHPSEGCFCPPD KVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQICTCLSGRKVNCTTQPCPTAKAPTCGLCEVA RLRQNADQCCPEYECVCDPVSCDLPPVPHCERGLQPTLTNPGECRPNFTCACRKEECKRVSPPSCPPHRL PTLRKTQCCDEYECACNCVNSTVSCPLGYLASTATNDCGCTTTTCLPDKVCVHRSTIYPVGQFWEEGCDV CTCTDMEDAVMGLRVAQCSQKPCEDSCRSGFTYVLHEGECCGRCLPSACEVVTGSPRGDSQSSWKSVGSQ WASPENPCLINECVRVKEEVFIQQRNVSCPQLEVPVCPSGFQLSCKTSACCPSCRCERMEACMLNGTVIG PGKTVMIDVCTTCRCMVQVGVISGFKLECRKTTCNPCPLGYKEENNTGECCGRCLPTACTIQLRGGQIMT LKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHKCLAEGGKIMKIPGTCCDTCEEPECNDITAR LQYVKVGSCKSEVEVDIHYCQGKCASKAMYSIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLN
AMECKCSPRKCSK
so, why bother making an article about it? -- Boris 21:20, 25 December 2005 (UTC)
- Because "It does hold the record for the longest word in an English language publication in a serious context, that is, for some reason other than to publish a very long word."--Prosfilaes 21:27, 2 May 2006 (UTC)
[edit] Technical restrictions
Ok, this is silly. Even if Mediawiki supported 2000-character titles, would we make the title the entire thing? No. Why? Because that's stupid. We choose our titles based on what is sensible, useful, meaningful and practical. A 1200 character long title is none of those. Therefore, the reason that we have a short title (in this case, the 30 odd character "Acetylseryltyrosylseryliso...serine") is purely editorial. If the only reason was technical, we would have a 255 character title. This contrasts with pages like EBay - there, we would really like to have the page title as "eBay", but it's just not possible, so we do the best we can. Hope this makes sense. Stevage 20:40, 1 June 2006 (UTC)
[edit] Spoken Text
As a test for Audacity software, and of my hardware and my voice and my patience (!) I've had a go at recording this... of course, I'll be very pleased to see others try and do a better / different job: this was just a bit of fun really. I followed the Spoken Wikipedia guidelines exactly, and used the full word as the title in my recording - I thought better to get the word over and done with straight away - followed by the 'from Wikipedia...' standard entry that always follows titles. I also noticed that in the text itself, reference is made to both 166 and then later 167 incidences of the ending -yl... I didn't count them, but used 166 in both references in my recording. Also, where the -yl in Butyl is often pronounced as with 'aisle', the -yl's in phenylanyline (sp?) are often pronounced as with 'ill'... so I had to pick one pronunciation, and chose the former throughout. Do leave any constructive feedback on my talk page if you feel like it! Patrickjoel 8 October 2006
